Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nostoc sp. NAD(P)H-quinone oxidoreductase chain 6(ndhG)

Recombinant Nostoc sp. NAD(P)H-quinone oxidoreductase chain 6(ndhG)

SKU:CSB-CF845569NHR

Regular price ¥277,200 JPY
Regular price Sale price ¥277,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)

Uniprot NO.:Q8Z075

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLAEGVQVVSFGILATMLIGTALGVVLATSIVYSAFLLGGVFISIAGMYLLLNGDFVAA AQVLVYVGAVNVLILFAIMLVNKRQDFTPYPSAGIRKVLTAIVSVGLFALLSTMVLATPW AYSTTPKVGDGSIIVIGEHFFSDFLLPFELASVLLLMAMVGAIILARREYLPEVTPSGLP QTVLTLPERPRELVGAGSETQE

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase chain 6 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I, chain 6 NDH-1, chain 6 NDH-G

Gene Names:Name:ndhG Ordered Locus Names:alr0225

Expression Region:1-202

Sequence Info:full length protein

View full details