Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 2(petC2)

Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 2(petC2)

SKU:CSB-CF846342NHR

Regular price ¥272,500 JPY
Regular price Sale price ¥272,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)

Uniprot NO.:Q93SW8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDDTLNQANPSMSRRQLLNFFTGAIVATTASAAIYPATKFFMPPAESTDAEGGILAQDKI GHPIPASQILAQASGTRALIAGLAGEPTYLTVREDGTLDPMGIVNNCTHLGCTFPWNPVD QQFQCPCHGSRYDAQGSVERGPANRPLKLVQVQVKDDYIWISPWQETDPRTGEKPWWV

Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit 2 EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2 Short name= ISP 2 Short name= RISP 2 Rieske iron-sulfur

Gene Names:Name:petC2 Ordered Locus Names:all4511

Expression Region:1-178

Sequence Info:full length protein

View full details