Recombinant Nostoc sp. Alr2278 protein(alr2278)

SKU: CSB-EP2490FUZ

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8YUQ7

Gene Names: alr2278

Organism: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

AA Sequence: MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD

Expression Region: 1-189aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 28.2 kDa

Alternative Name(s):

Relevance:

Reference: "Structure of cinaciguat (BAY 58-2667) bound to Nostoc H-NOX domain reveals insights into heme-mimetic activation of the soluble guanylyl cyclase." Martin F., Baskaran P., Ma X., Dunten P.W., Schaefer M., Stasch J.P., Beuve A., van den Akker F. J. Biol. Chem. 285:22651-22657(2010)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.