
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Uniprot NO.:B2J3K1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:IVKTLLIAIATVTFYFTSDLALPQSAAAYPFWAQQTYPETPREPTGRIVCANCHLAAKVT EVEVPQSVLPDTVFKAIVKIPYDLSAQQVGADGSKVGLNVGAVLMLPEGFKIAPEDRISE ELKEEIGDTAFQPYSEDKENVVIVGPLPGEQYQEIIFPVLSPNPATDKNIHFGKYSVHVG GNRGRGQVYPTGEKSNNSVYNASATGTITKIAKEEDADGNVKYLVNIQPESGDVVVDTVP LGPDLIVSEGQAVKTGDALTNNPNVGGFGQIDAEIVLQDSSRVKWMIAFVALVMLAQVML VLKKKQVEKVQAAEMNF
Protein Names:Recommended name: Apocytochrome f
Gene Names:Name:petA Ordered Locus Names:Npun_R0131
Expression Region:17-333
Sequence Info:full length protein
You may also like
-
Recombinant Nostoc sp. Apocytochrome f(petA)
- Regular price
- ¥242,200 JPY
- Sale price
- ¥242,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nostoc sp. Apocytochrome f(petA)
- Regular price
- ¥242,200 JPY
- Sale price
- ¥242,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Apocytochrome f(petA)
- Regular price
- ¥241,500 JPY
- Sale price
- ¥241,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Apocytochrome f(petA)
- Regular price
- ¥241,600 JPY
- Sale price
- ¥241,600 JPY
- Regular price
-
- Unit price
- per
Sold out