Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nitrosomonas europaea Na(+)-translocating NADH-quinone reductase subunit E(nqrE)

Recombinant Nitrosomonas europaea Na(+)-translocating NADH-quinone reductase subunit E(nqrE)

SKU:CSB-CF772502NHH

Regular price ¥270,400 JPY
Regular price Sale price ¥270,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298)

Uniprot NO.:Q82SE7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSLAGLFITAVFVENLALTFFLGMCTFLAISKKIEVAFGMGIAVIVVQTLTVPINNLVY QYLLRDGALVWAGLAEIDLTFLGLVSYLGVIAAIVQILEMFLDRFMPALHSALGIYLPLI AVNCAILGGSLFMVERDYNFTESLVYGLGSGFGWALAIVALAGVRERLKYSDVPDGLQGL GITFISAGLMAMGFMAFSGIRL

Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit E Short name= Na(+)-NQR subunit E Short name= Na(+)-translocating NQR subunit E EC= 1.6.5.- Alternative name(s): NQR complex subunit E NQR-1 subunit E

Gene Names:Name:nqrE Ordered Locus Names:NE2393

Expression Region:1-202

Sequence Info:full length protein

View full details