Gene Bio Systems
Recombinant Nitrobacter hamburgensis UPF0060 membrane protein Nham_2004(Nham_2004)
Recombinant Nitrobacter hamburgensis UPF0060 membrane protein Nham_2004(Nham_2004)
SKU:CSB-CF631001NAAF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nitrobacter hamburgensis (strain X14 / DSM 10229)
Uniprot NO.:Q1QLU4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MITSAAYVGAAVAEIAGCFAFWAWLRLGKSVWWLAPGMVSLALFAYLLTLVDSEAAGRAY AAYGGVYIIASLGWLWSVEGLRPDRWDLTGAAICLLGAAIILFGPRQI
Protein Names:Recommended name: UPF0060 membrane protein Nham_2004
Gene Names:Ordered Locus Names:Nham_2004
Expression Region:1-108
Sequence Info:full length protein
