Skip to product information
1 of 1

Gene Bio Systems

Recombinant NIP3 homolog(dct-1)

Recombinant NIP3 homolog(dct-1)

SKU:CSB-CF601051CXY

Regular price ¥277,900 JPY
Regular price Sale price ¥277,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q09969

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLDIKRKINFASGEKTDESVQPQQQTEQSSAQQTTPSAKAVSNPFITPLTESTPGMSESW VELAPSRTSLCSSVDINMVIIDEKDKDSRLSPVSIAQSPHVEFESLEQVKYKLVREMLPP GKNTDWIWDWSSRPENTPPKTVRMVQYGSNLTTPPNSPEPELYQYLPCESDSLFNVRVVF GFLVTNIFSFVVGAAVGFAVCRKLIKHHRQ

Protein Names:Recommended name: NIP3 homolog Short name= CeBNIP3 Alternative name(s): Daf-16/FOXO controlled germline tumor affecting

Gene Names:Name:dct-1 ORF Names:C14F5.1

Expression Region:1-210

Sequence Info:full length protein

View full details