Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nicotinamide riboside transporter pnuC(pnuC)

Recombinant Nicotinamide riboside transporter pnuC(pnuC)

SKU:CSB-CF360278SZB

Regular price ¥283,500 JPY
Regular price Sale price ¥283,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0AFK3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFFSVQNILVHIPIGAGGYDLSWIEAVGTIAGLLCIGLASLEKISNYFFGLINVTLFGI IFFQIQLYASLLLQVFFFAANIYGWYAWSRQTSQNEAELKIRWLPLPKALSWLAVCVVSI GLMTVFINPVFAFLTRVAVMIMQALGLQVVMPELQPDAFPFWDSCMMVLSIVAMILMTRK YVENWLLWVIINVISVVIFALQGVYAMSLEYIILTFIALNGSRMWINSARERGSRALSH

Protein Names:Recommended name: Nicotinamide riboside transporter pnuC

Gene Names:Name:pnuC Ordered Locus Names:SF0553, S0561

Expression Region:1-239

Sequence Info:full length protein

View full details