Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 7, chloroplastic(CAB7)

Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 7, chloroplastic(CAB7)

SKU:CSB-CF326722NHE

Regular price ¥282,700 JPY
Regular price Sale price ¥282,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nicotiana tabacum (Common tobacco)

Uniprot NO.:P27491

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLDNLVDHLADPVNNNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 7, chloroplastic Alternative name(s): LHCII type I CAB-7 Short name= LHCP

Gene Names:Name:CAB7

Expression Region:36-267

Sequence Info:full length protein

View full details