Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nicotiana tabacum ATP synthase protein MI25

Recombinant Nicotiana tabacum ATP synthase protein MI25

SKU:CSB-CF362573NHE

Regular price ¥276,000 JPY
Regular price Sale price ¥276,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nicotiana tabacum (Common tobacco)

Uniprot NO.:P09003

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLSSTNMQARKMLFAAILSICASSSKKISIYNEEMIVALCFIGFIIFSWKSLGKTFKVT LDGRIQAIQEESQQFPNPNEVVPPESNEQQRLLRISLRICGTVVESLPMARCAPKCEKTV QALLCRNLNVKSATLPNATSSRRIRLQDDIAIKMHVLVGKRFCPWCSSKAERVEFIRESL VVLRMVWVGDSLKNKELE

Protein Names:Recommended name: ATP synthase protein MI25 Alternative name(s): ORF 25

Gene Names:

Expression Region:1-198

Sequence Info:full length protein

View full details