
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nicotiana plumbaginifolia (Leadwort-leaved tobacco) (Tex-Mex tobacco)
Uniprot NO.:P12469
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein C, chloroplastic Alternative name(s): LHCII type I CAB-C Short name= LHCP
Gene Names:Name:CABC
Expression Region:36-267
Sequence Info:full length protein
You may also like
-
Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein E, chloroplastic(CABE)
- Regular price
- ¥183,000 JPY
- Sale price
- ¥183,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 40, chloroplastic(CAB40)
- Regular price
- ¥183,000 JPY
- Sale price
- ¥183,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 50, chloroplastic(CAB50)
- Regular price
- ¥183,000 JPY
- Sale price
- ¥183,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 16, chloroplastic(CAB16)
- Regular price
- ¥183,000 JPY
- Sale price
- ¥183,000 JPY
- Regular price
-
- Unit price
- per
Sold out