Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa Presequence translocated-associated motor subunit pam-17, mitochondrial(pam-17)

Recombinant Neurospora crassa Presequence translocated-associated motor subunit pam-17, mitochondrial(pam-17)

SKU:CSB-CF759656NHA

Regular price ¥272,700 JPY
Regular price Sale price ¥272,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7SEE1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSTRPRSDAELDANAAEAAAAAQSAAHAGEPVLDWNTFFKLRKTRRRVQLAFSVIMTLIT SGAGGAVLSTGVADAMVAQVPLEPMFAVGLMTASFGALGWLMGPAMGGMVFNALKSKYRG QMEIKEGQFFARIKKHRVDPSASSMGNPVPDFYGEKISSVAGYRQWLKDQRAFNKKRTTF V

Protein Names:Recommended name: Presequence translocated-associated motor subunit pam-17, mitochondrial

Gene Names:Name:pam-17 ORF Names:NCU00737

Expression Region:87-267

Sequence Info:full length protein

View full details