Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa Mitochondrial intermembrane space import and assembly protein 40(mia-40)

Recombinant Neurospora crassa Mitochondrial intermembrane space import and assembly protein 40(mia-40)

SKU:CSB-CF745780NHA

Regular price ¥290,000 JPY
Regular price Sale price ¥290,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7S3S2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASTTSAPKKKSTWKGAAVRWGLAVAAVYYYNTSPIFSDELPETAGTAPSQLTDADLPTVD AIVEEKRRQAAEHAAARKAAQAAAKAAATPATPSESVEEQITKAEAEAEAVPEGDSKPRS ESTEGVIPEAGASPEALQEEADAQGAFNPETGEINWDCPCLGGMAHGPCGEEFKAAFSCF VYSTEEPKGMDCIEKFSHMQDCFRKYPEVYGAELADDEEAERASAAAPAAEGTPAKEEPV ENKKEEALEPATHDATAANNNKKQQ

Protein Names:Recommended name: Mitochondrial intermembrane space import and assembly protein 40 Alternative name(s): Mitochondrial import inner membrane translocase TIM40

Gene Names:Name:mia-40 Synonyms:tim-40 ORF Names:NCU04945

Expression Region:34-298

Sequence Info:full length protein

View full details