Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa Assembly factor cbp-4(cbp-4)

Recombinant Neurospora crassa Assembly factor cbp-4(cbp-4)

SKU:CSB-CF766439NHA

Regular price ¥261,700 JPY
Regular price Sale price ¥261,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7SDU5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAKKPVNWWLWTKMLLGGAAICVGGPAFTYWLTPTDEELFQKYNPELQKRSLERRFERQ QEFDDFVTKLKEYSKSDKPIWTVQAEAEEKERQQRASVQKSLALADEVKARKEAMRREAG LPLEK

Protein Names:Recommended name: Assembly factor cbp-4 Alternative name(s): Cytochrome b mRNA-processing protein 4

Gene Names:Name:cbp-4 ORF Names:5C2.060, NCU03147

Expression Region:1-125

Sequence Info:full length protein

View full details