Gene Bio Systems
Recombinant Nematostella vectensis UPF0443 protein v1g164247 (v1g164247)
Recombinant Nematostella vectensis UPF0443 protein v1g164247 (v1g164247)
SKU:CSB-CF415233NGO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nematostella vectensis (Starlet sea anemone)
Uniprot NO.:A7RYM7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRQLPGKAAKETRKMKRERKQQNKEGHNRVVTVAIPVCLAVFVMLIVYVYSATSKHRKWA RR
Protein Names:Recommended name: UPF0443 protein v1g164247
Gene Names:ORF Names:v1g164247
Expression Region:1-62
Sequence Info:full length protein
