Gene Bio Systems
Recombinant Neisseria gonorrhoeae UPF0756 membrane protein NGK_2061 (NGK_2061)
Recombinant Neisseria gonorrhoeae UPF0756 membrane protein NGK_2061 (NGK_2061)
SKU:CSB-CF457764NGB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neisseria gonorrhoeae (strain NCCP11945)
Uniprot NO.:B4RNN7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFSFVPLFLVTLILLGVVSNNNSITVSATILLLMQQTALVQFVPLVEKHGLNLGIILLT IGVLSPLVSGKAQVPPVAEFLNFKMISAVFIGIFVAWLAGCGVPLMGRQPVLVTGLLIGT VIGVAFMGGIPVGPLIAADILSFVAGKV
Protein Names:Recommended name: UPF0756 membrane protein NGK_2061
Gene Names:Ordered Locus Names:NGK_2061
Expression Region:1-148
Sequence Info:full length protein
