Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria gonorrhoeae Probable intracellular septation protein A(NGO1659)

Recombinant Neisseria gonorrhoeae Probable intracellular septation protein A(NGO1659)

SKU:CSB-CF691683NGA

Regular price ¥272,600 JPY
Regular price Sale price ¥272,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)

Uniprot NO.:Q5F6A1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFVSDLLSVILFFATYTVTKNMIAAAAVALVAGVVQAAFLYWKHKRLDTMQWVGLVLIV VFGGATIVLGDSRFIMWKPTVLFWCGALFLLGSHLAGKNGLKASIGREIQLPDAVWGKLT YMWVGFLIFMGIANWFVFTRFEAQWVNYKMFGSTALMLFFFIIQGIYLSTYLKKED

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:NGO1659

Expression Region:1-176

Sequence Info:full length protein

View full details