Skip to product information
1 of 1

Gene Bio Systems

Recombinant Natranaerobius thermophilus UPF0756 membrane protein Nther_1957 (Nther_1957)

Recombinant Natranaerobius thermophilus UPF0756 membrane protein Nther_1957 (Nther_1957)

SKU:CSB-CF452225NFO

Regular price ¥267,700 JPY
Regular price Sale price ¥267,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)

Uniprot NO.:B2A6J4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFHEIVVLLFIFLIALIGKNDLVATAGALLFVMKFSPLSNVFPFLTERGIELGILLLTLS VLTPFAAGDIMPRDLLSTLKSPAGLIAVFSGIVASYLTGHGVELLRSRPEVMVGLIVGSI IGASFLKGVPAGPLVAAGLAAVLIKSLNL

Protein Names:Recommended name: UPF0756 membrane protein Nther_1957

Gene Names:Ordered Locus Names:Nther_1957

Expression Region:1-149

Sequence Info:full length protein

View full details