Skip to product information
1 of 1

Gene Bio Systems

Recombinant Narcissus mosaic virus Movement protein TGB2 (ORF3)

Recombinant Narcissus mosaic virus Movement protein TGB2 (ORF3)

SKU:CSB-CF323338NAR

Regular price ¥256,800 JPY
Regular price Sale price ¥256,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Narcissus mosaic virus (NMV)

Uniprot NO.:P15097

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPGLTPPVNYEQVYKVLAIGFLLCASIYCLRSNHLPHVGDNIHSLPHGGNYADGTKRVQY FRPHSSTSTNHKYTALCAVLTLSLLIFAQTRLAAGNRITSVSICHHCSSQGSLSGGNHGR VSGHSELPTT

Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 14 kDa protein Triple gene block 2 protein Short name= TGBp2

Gene Names:ORF Names:ORF3

Expression Region:1-130

Sequence Info:full length protein

View full details