Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_579 (MPN_579)

CSB-CF300448MLW

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75201

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENKEQNNTDQLQTGDLNKARKLHKCYLWLFVVSLIIWLGFISLFFLYYLPISLVIALVV IAFIFVLVFLGFLETWRKNINQEEEFLRLEGLLITSPTDTQSAIHKDNQ

Protein Names:Recommended name: Uncharacterized protein MPN_579

Gene Names:Ordered Locus Names:MPN_579 ORF Names:D02_orf109, MP263

Expression Region:1-109

Sequence Info:full length protein