Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_272(MPN_272)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_272(MPN_272)

SKU:CSB-CF875384MLW

Regular price ¥222,000 JPY
Regular price Sale price ¥222,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:Q9EXD2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNRPTPNFEAIDKKISAFVTNHDNLLDKLLKQQTELLTSEITTNFEVTQQIQEEVAKKTK QHSKNYKWLVTVVLANGVVSLFLLGGLIYLFSK

Protein Names:Recommended name: Uncharacterized protein MPN_272

Gene Names:Ordered Locus Names:MPN_272 ORF Names:A65_orf94, MP562.1

Expression Region:1-93

Sequence Info:full length protein

View full details