Recombinant Mycoplasma pneumoniae Putative phosphotransferase enzyme IIB component MPN_268 (MPN_268)

SKU: CSB-CF300490MLW

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75507

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKVLLWIGYVLSFGLLYLYLVKRAKRAALQLNNKLVESHTIPFAVRDFIAACGGRTNFVSLRTSPTQLIVSFAKPELVQIAALQKLGIKGINKSQNQYRFVLGNFVNQLKQQIENER

Protein Names:Recommended name: Putative phosphotransferase enzyme IIB component MPN_268 EC= 2.7.1.69 Alternative name(s): Putative PTS system EIIB component

Gene Names:Ordered Locus Names:MPN_268 ORF Names:A65_orf117, MP565

Expression Region:1-117

Sequence Info:full length protein