Recombinant Mycoplasma hyopneumoniae ATP synthase subunit c(atpE)

SKU: CSB-CF670011MLQ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)

Uniprot NO.:Q4AAW2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSIVNFSQQLIQNFQEVSQRTAADSSNLKAFAYLGAGLAMIGVIGVGAGQGYAAGKACD AIARNPEAQKQVFRVLVIGTAISETSSIYALLVALILIFVG

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:MHJ_0044

Expression Region:1-101

Sequence Info:full length protein