Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase(cyp125)

Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase(cyp125)

SKU:CSB-EP351308MVZ-GB

Regular price ¥157,500 JPY
Regular price Sale price ¥157,500 JPY
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P9WPP1

Gene Names: cyp125

Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

AA Sequence: MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

Expression Region: 1-433aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 64.4 kDa

Alternative Name(s): Cholest-4-en-3-one 26-monooxygenaseCytochrome P450 125Steroid C27-monooxygenase

Relevance: Catalyzes the C-27 hydroxylation of cholest-4-en-3-one and cholesterol and subsequently oxidizes the alcohol of the former to the cholest-4-en-3-one-27-oic acid via the aldehyde intermediate. Not required to incorporate the cholesterol side-chain carbon atoms into cellular lipids.

Reference: Reverse type I inhibitor of Mycobacteriumtuberculosis CYP125A1.Ouellet H., Kells P.M., Ortiz de Montellano P.R., Podust L.M.Bioorg. Med. Chem. Lett. 21:332-337(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)