Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium sp. UPF0060 membrane protein Mmcs_2513(Mmcs_2513)

Recombinant Mycobacterium sp. UPF0060 membrane protein Mmcs_2513(Mmcs_2513)

SKU:CSB-CF623392MLF

Regular price ¥260,000 JPY
Regular price Sale price ¥260,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium sp. (strain MCS)

Uniprot NO.:Q1B913

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQPD AHFGRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR

Protein Names:Recommended name: UPF0060 membrane protein Mmcs_2513

Gene Names:Ordered Locus Names:Mmcs_2513

Expression Region:1-113

Sequence Info:full length protein

View full details