Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium marinum UPF0233 membrane protein MMAR_0013 (MMAR_0013)

Recombinant Mycobacterium marinum UPF0233 membrane protein MMAR_0013 (MMAR_0013)

SKU:CSB-CF454321MVS

Regular price ¥257,200 JPY
Regular price Sale price ¥257,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium marinum (strain ATCC BAA-535 / M)

Uniprot NO.:B2HI58

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKSKVRKKNDFTVKPVSRTPVKVKVGPSSVWFVALFIGLMLIGLVWLMVFQLAAVGSQA PAALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Protein Names:Recommended name: UPF0233 membrane protein MMAR_0013

Gene Names:Ordered Locus Names:MMAR_0013

Expression Region:1-93

Sequence Info:full length protein

View full details