Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium bovis 14 kDa antigen(hspX)

Recombinant Mycobacterium bovis 14 kDa antigen(hspX)

SKU:CSB-BP358651MVH

Regular price ¥100,000 JPY
Regular price Sale price ¥100,000 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: hspX

Biologically active: Not Tested

Expression system: Baculovirus

Species of origin: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Delivery time: 3-7 business days

Uniprot ID: P0A5B8

AA Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Tag info: N-terminal 6xHis-tagged

Expression Region: 2-144aa

Protein length: Full Length

MW: 18.1 kDa

Alternative Name(s): 16 kDa antigen HSP 16.3

Relevance:

Reference: "Updated reference genome sequence and annotation of Mycobacterium bovis AF2122/97." Malone K.M., Farrell D., Stuber T.P., Schubert O.T., Aebersold R., Robbe-Austerman S., Gordon S.V. Genome Announc. 5:E00157-E00157(2017)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details