Skip to product information
1 of 1

Gene Bio Systems

Recombinant Musca domestica Cytochrome b5(Cyt-b5)

Recombinant Musca domestica Cytochrome b5(Cyt-b5)

SKU:CSB-CF006309MVC

Regular price ¥264,000 JPY
Regular price Sale price ¥264,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Musca domestica (House fly)

Uniprot NO.:P49096

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSEDVKYFTRAEVAKNNTKDKNWFIIHNNVYDVTAFLNEHPGGEEVLIEQAGKDATEHF EDVGHSSDAREMMKQYKVGELVAEERSNVPEKSEPTWNTEQKTEESSMKSWLMPFVLGLV ATLIYKFFFGTKSQ

Protein Names:Recommended name: Cytochrome b5 Short name= CYTB5

Gene Names:Name:Cyt-b5

Expression Region:1-134

Sequence Info:full length protein

View full details