Recombinant Mouse Vesicle-associated membrane protein 4(Vamp4)

SKU: CSB-CF025783MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O70480

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILLLMIIILIVVKFRT

Protein Names:Recommended name: Vesicle-associated membrane protein 4 Short name= VAMP-4

Gene Names:Name:Vamp4

Expression Region:1-141

Sequence Info:full length protein