Gene Bio Systems
Recombinant Mouse Uroplakin-2(Upk2)
Recombinant Mouse Uroplakin-2(Upk2)
SKU:CSB-CF025656MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P38575
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK
Protein Names:Recommended name: Uroplakin-2 Short name= UP2Alternative name(s): Uroplakin II Short name= UPII
Gene Names:Name:Upk2
Expression Region:85-184
Sequence Info:full length protein
