Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor protein p53-inducible protein 11(Trp53i11)

Recombinant Mouse Tumor protein p53-inducible protein 11(Trp53i11)

SKU:CSB-CF689920MO

Regular price ¥274,400 JPY
Regular price Sale price ¥274,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q4QQM4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFLSAMLFSSVAIMALALPDQLYDAVFDGAEVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFGVQSLVVTATLAETGLMSLGTVLLLASRLLFVIVSIYYYY QVGRKPKKV

Protein Names:Recommended name: Tumor protein p53-inducible protein 11 Alternative name(s): Transformation related protein 53 inducible protein 11 p53-induced gene 11 protein

Gene Names:Name:Trp53i11 Synonyms:Pig11, Tp53i11

Expression Region:1-189

Sequence Info:full length protein

View full details