Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor necrosis factor receptor superfamily member 5(Cd40)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 5(Cd40)

SKU:CSB-CF004936MO

Regular price ¥284,900 JPY
Regular price Sale price ¥284,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P27512

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV

Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 5 Alternative name(s): B-cell surface antigen CD40 Bp50 CD40L receptor CD_antigen= CD40

Gene Names:Name:Cd40 Synonyms:Tnfrsf5

Expression Region:20-289

Sequence Info:full length protein

View full details