Recombinant Mouse Transthyretin(Ttr),partial

Recombinant Mouse Transthyretin(Ttr),partial

CSB-EP025270MO1e1
Regular price
¥104,100 JPY
Sale price
¥104,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: Ttr

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P07309

AA Sequence: AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Tag info: NO-tagged

Expression Region: 23-147aa

Protein length: Partial

MW: 13.5 kDa

Alternative Name(s): Prealbumin

Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Reference: "Structural comparisons between mouse and human prealbumin." Wakasugi S., Maeda S., Shimada K., Nakashima H., Migita S. J. Biochem. 98:1707-1714(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share