
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P07309
Gene Names: Ttr
Organism: Mus musculus (Mouse)
AA Sequence: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Expression Region: 21-147aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 29.6 kDa
Alternative Name(s): Prealbumin
Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Reference: Human-murine transthyretin heterotetramers are kinetically stable and non-amyloidogenic. A lesson in the generation of transgenic models of diseases involving oligomeric proteins.Reixach N., Foss T.R., Santelli E., Pascual J., Kelly J.W., Buxbaum J.N.J. Biol. Chem. 283:2098-2107(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Transthyretin(Ttr)
- Regular price
- ¥119,800 JPY
- Sale price
- ¥119,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr),partial
- Regular price
- ¥105,500 JPY
- Sale price
- ¥105,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr),partial
- Regular price
- ¥105,500 JPY
- Sale price
- ¥105,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr),partial
- Regular price
- ¥106,200 JPY
- Sale price
- ¥106,200 JPY
- Regular price
-
- Unit price
- per
Sold out