Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Transmembrane protein 88B(Tmem88b)

Recombinant Mouse Transmembrane protein 88B(Tmem88b)

SKU:CSB-CF663638MO

Regular price ¥270,800 JPY
Regular price Sale price ¥270,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q3TYP4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEQERETEEDEGVASDTAPMLPRRRPTDYHISVLAPILATRGLGTLVLSGRALVGFLLH LLLPGTVFLLVLLPAAAVVYLGFLCHSRVHPAPGPRCRALLSDRGSAALIVFGLLSLPPL VVLAAAARSLLVRRLRPALPDPARTPAPRRPPRSSGDLADGHPDEDKQLCAWV

Protein Names:Recommended name: Transmembrane protein 88B

Gene Names:Name:Tmem88b

Expression Region:1-173

Sequence Info:full length protein

View full details