Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Transmembrane protease serine 4(Tmprss4),partial

Recombinant Mouse Transmembrane protease serine 4(Tmprss4),partial

SKU:CSB-EP844988MO

Regular price ¥140,500 JPY
Regular price Sale price ¥140,500 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: Tmprss4

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q8VCA5

AA Sequence: KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 52-435aa

Protein length: Extracellular Domain

MW: 57.8 kDa

Alternative Name(s): Channel-activating protease 2 ;mCAP2

Relevance: Probable protease. Ses to be capable of activating ENaC.

Reference: Synergistic activation of ENaC by three membrane-bound channel-activating serine proteases (mCAP1, mCAP2, and mCAP3) and serum- and glucocorticoid-regulated kinase (Sgk1) in Xenopus oocytes.Vuagniaux G., Vallet V., Jaeger N.F., Hummler E., Rossier B.C.J. Gen. Physiol. 120:191-201(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details