Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 2(Tmco2)

Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 2(Tmco2)

SKU:CSB-CF023646MO

Regular price ¥273,300 JPY
Regular price Sale price ¥273,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P0C1V4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPTFPTTTSSWDNLLNALARSSIWNWLQAMFIGETTSAPQPTNLGILDNLAPAVQIILGI SFLTLLAIGLFALWKRSIRSIQKIVMFVITLYQLYKKGSDFFQVLLANPEGSGRQIQDNN NIFLSLGLQEKILKKLQMVENKVRDLEGIIVARKPASKRDCSSEPYCSCSDCQSPLPTSG FTS

Protein Names:Recommended name: Transmembrane and coiled-coil domain-containing protein 2

Gene Names:Name:Tmco2

Expression Region:1-183

Sequence Info:Full length protein

View full details