Gene Bio Systems
Recombinant Mouse Translocator protein 2(Tspo2)
Recombinant Mouse Translocator protein 2(Tspo2)
SKU:CSB-CF880422MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CRZ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQLQGPVFVGVPLLGPILICMLIHQPSSRCEDERKLPWCPPHKVILLVWVTIYSVMGYAS YLVWKELGGGFRWPLALPLGLYSFQLALSWTFLVLFLAADSPGLALLDLLLLYGLVASLV FIWQPINKLAALLLLPYLAWLTVTTAITYRLWRDSLCPTYQP
Protein Names:Recommended name: Translocator protein 2 Alternative name(s): Peripheral-type benzodiazepine receptor-like protein 1
Gene Names:Name:Tspo2 Synonyms:Bzrpl1
Expression Region:1-162
Sequence Info:full length protein
