Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tenomodulin(Tnmd),partial

Recombinant Mouse Tenomodulin(Tnmd),partial

SKU:CSB-EP024007MO

Regular price ¥148,700 JPY
Regular price Sale price ¥148,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:Q9EP64

Gene Names:Tnmd

Organism:Mus musculus (Mouse)

AA Sequence:KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV

Expression Region:51-317aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:35.6 kDa

Alternative Name(s):Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)

Relevance:May be an angiogenesis inhibitor.

Reference:"Chondromodulin I is dispensable during enchondral ossification and eye development." Brandau O., Aszodi A., Hunziker E.B., Neame P.J., Vestweber D., Fassler R. Mol. Cell. Biol. 22:6627-6635(2002)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-81?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 5? for up to one week.

Function:May be an angiogenesis inhibitor.

Involvement in disease:

Subcellular Location:Membrane, Single-pass type II membrane protein, Nucleus envelope

Protein Families:Chondromodulin-1 family

Tissue Specificity:Widely expressed with highest expression in tendons and ligaments, in the diaphragm, eye and skeletal muscle. Expressed in neuronal cells of all brain regions. Very low expression, if any, in glial cells.

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=46221

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:64103

STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000033602

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details