Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tail-anchored protein insertion receptor WRB(Wrb)

Recombinant Mouse Tail-anchored protein insertion receptor WRB(Wrb)

SKU:CSB-CF811678MO

Regular price ¥271,200 JPY
Regular price Sale price ¥271,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8K0D7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSASETDRWAWLLVLSFVFGCNLLRILLPSLSSFISRVLQKDAEQESQMRAEIQGMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWFISVAFYILQAALMISLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGIGITCWILVCNKVVAIVLHPFS

Protein Names:Recommended name: Tail-anchored protein insertion receptor WRB Alternative name(s): Tryptophan-rich basic protein Short name= WRB

Gene Names:Name:Wrb

Expression Region:1-174

Sequence Info:full length protein

View full details