Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse T-cell surface antigen CD2(Cd2)

Recombinant Mouse T-cell surface antigen CD2(Cd2)

SKU:CSB-CF004894MO

Regular price ¥294,700 JPY
Regular price Sale price ¥294,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P08920

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKDEELEIKASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN

Protein Names:Recommended name: T-cell surface antigen CD2 Alternative name(s): LFA-2 LFA-3 receptor Lymphocyte antigen 37 Short name= Ly-37 T-cell surface antigen T11/Leu-5 CD_antigen= CD2

Gene Names:Name:Cd2 Synonyms:Ly-37

Expression Region:23-344

Sequence Info:full length protein

View full details