Recombinant Mouse T-cell antigen CD7(Cd7)

SKU: CSB-CF004953MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P50283

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPAAIAVGFFFTGLLLGVVCSMLRKIQIKKLCASGIKESPCVVYEDMSYSNRKTPCIPNQYQ

Protein Names:Recommended name: T-cell antigen CD7 Alternative name(s): CD_antigen= CD7

Gene Names:Name:Cd7

Expression Region:24-210

Sequence Info:full length protein