Gene Bio Systems
Recombinant Mouse Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(Sdhc)
Recombinant Mouse Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(Sdhc)
SKU:CSB-CF871934MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CZB0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LGTTAKEEMERFWKKNTSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSA LLLPGNFESYLMFVKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVW LSGVAVVVLAVLSSGGLAAL
Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial Alternative name(s): Integral membrane protein CII-3 QPs-1 Short name= QPs1
Gene Names:Name:Sdhc
Expression Region:30-169
Sequence Info:full length protein
