GeneBio Systems
Recombinant Mouse Solute carrier family 22 member 17 (Slc22a17), partial
Recombinant Mouse Solute carrier family 22 member 17 (Slc22a17), partial
SKU:Q9D9E0
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q9D9E0
Gene Names: Slc22a17
Alternative Name(s): 24p3 receptor;24p3R;Brain-type organic cation transporter;Lipocalin-2 receptor
Abbreviation: Recombinant Mouse Slc22a17 protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 121-183aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: ARWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQELENTCPLPATSTFSFASLLNYR
MW: 14.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cell surface receptor for LCN2 (24p3) that plays a key role in iron homeostasis and transport. Able to bind iron-bound LCN2 (holo-24p3), followed by internalization of holo-24p3 and release of iron, thereby increasing intracellular iron concentration and leading to inhibition of apoptosis. Also binds iron-free LCN2 (apo-24p3), followed by internalization of apo-24p3 and its association with an intracellular siderophore, leading to iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration and resulting in apoptosis.
Reference:
Function:
