Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 2(Nkain2)

Recombinant Mouse Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 2(Nkain2)

SKU:CSB-CF706015MO

Regular price ¥277,600 JPY
Regular price Sale price ¥277,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q4PNJ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR YVTGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCMVTSV TPAPDWAPEDHRYITVSGCFLDYQYIEVAHSSLQIVLALAGFIYACYVVRCITEEEDSFD FIGGFDSYGYQGPQKTSHLQLQPMYMSK

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2 Alternative name(s): T-cell lymphoma breakpoint-associated target pr

Gene Names:Name:Nkain2 Synonyms:Tcba1

Expression Region:1-208

Sequence Info:full length protein

View full details