Gene Bio Systems
Recombinant Mouse Serum amyloid A-3 protein(Saa3)
Recombinant Mouse Serum amyloid A-3 protein(Saa3)
SKU:CSB-YP361411MO
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P04918
Gene Names: Saa3
Organism: Mus musculus (Mouse)
AA Sequence: RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Expression Region: 20-122aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 13.8 kDa
Alternative Name(s):
Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.
Reference: The sequence and structure of a new serum amyloid A gene.Stearman R.S., Lowell C.A., Peltzman C.G., Morrow J.F.Nucleic Acids Res. 14:797-809(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
