Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Serine palmitoyltransferase small subunit A(Sptssa)

Recombinant Mouse Serine palmitoyltransferase small subunit A(Sptssa)

SKU:CSB-CF823162MO

Regular price ¥217,900 JPY
Regular price Sale price ¥217,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8R207

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVVGMALYTGYVFMPQHI MAILHYFEIVQ

Protein Names:Recommended name: Serine palmitoyltransferase small subunit A Alternative name(s): Small subunit of serine palmitoyltransferase A Short name= ssSPTa

Gene Names:Name:Sptssa Synonyms:Ssspta

Expression Region:1-71

Sequence Info:full length protein

View full details