Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Secretoglobin family 3A member 2(Scgb3a2)

Recombinant Mouse Secretoglobin family 3A member 2(Scgb3a2)

SKU:CSB-EP846028MO

Regular price ¥157,400 JPY
Regular price Sale price ¥157,400 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Epigenetics and Nuclear Signaling

Target / Protein: Scgb3a2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q920H1

AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Tag info: N-terminal 6xHis-GST-tagged

Expression Region: 22-139aa

Protein length: Full Length of Mature Protein

MW: 43.2 kDa

Alternative Name(s): Pneumo secretory protein 1

Relevance: Enzyme and pathway databases

Reference: "UGRP1, a uteroglobin/Clara cell secretory protein-related protein, is a novel lung-enriched downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor."Niimi T., Keck-Waggoner C.L., Popescu N.C., Zhou Y., Levitt R.C., Kimura S.Mol. Endocrinol. 15:2021-2036(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details