Recombinant Mouse Secreted frizzled-related protein 5(Sfrp5)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Secreted frizzled-related protein 5(Sfrp5)

CSB-EP021141MO
Regular price
¥106,200 JPY
Sale price
¥106,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Stem Cells

Target / Protein: Sfrp5

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q9WU66

AA Sequence: APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH

Tag info: N-terminal 6xHis-tagged

Expression Region: 22-314aa

Protein length: Full Length of Mature Protein

MW: 37.2 kDa

Alternative Name(s):

Relevance: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina.

Reference: "Absence of Nodal signaling promotes precocious neural differentiation in the mouse embryo." Camus A., Perea-Gomez A., Moreau A., Collignon J. Dev. Biol. 295:743-755(2006)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Secreted frizzled-related protein 5(Sfrp5)
    Regular price
    ¥106,200 JPY
    Sale price
    ¥106,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Protein Wnt-8b(Wnt8b)
    Regular price
    ¥124,800 JPY
    Sale price
    ¥124,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Protein Wnt-8b(Wnt8b)
    Regular price
    ¥124,800 JPY
    Sale price
    ¥124,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Protein Wnt-3a(Wnt3a)
    Regular price
    ¥94,000 JPY
    Sale price
    ¥94,000 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share