Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Scrapie-responsive protein 1(Scrg1)

Recombinant Mouse Scrapie-responsive protein 1(Scrg1)

SKU:CSB-YP526023MO

Regular price ¥134,400 JPY
Regular price Sale price ¥134,400 JPY
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: O88745

Gene Names: Scrg1

Organism: Mus musculus (Mouse)

AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Expression Region: 21-98aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11 kDa

Alternative Name(s): Scrapie-responsive gene 1 protein ;ScRG-1

Relevance:

Reference: Gene expression in scrapie. Cloning of a new scrapie-responsive gene and the identification of increased levels of seven other mRNA transcripts.Dandoy-Dron F., Guillo F., Benboudjema L., Deslys J.-P., Lasmesas C., Dormont D., Tovey M.G., Dron M.J. Biol. Chem. 273:7691-7697(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)